name: blast-searches description: Run remote BLAST searches against NCBI databases using Biopython Bio.Blast. Use when identifying unknown sequences, finding homologs, or searching for sequence similarity against NCBI's nr/nt databases. tool_type: python primary_tool: Bio.Blast.NCBIWWW
Version Compatibility
Reference examples tested with: BioPython 1.83+, NCBI BLAST+ 2.15+
Before using code patterns, verify installed versions match. If versions differ:
- Python:
pip show <package>thenhelp(module.function)to check signatures
If code throws ImportError, AttributeError, or TypeError, introspect the installed package and adapt the example to match the actual API rather than retrying.
BLAST Searches
"BLAST this sequence against NCBI" → Submit a query sequence to NCBI BLAST servers, retrieve XML results, and parse hits with E-values and identity scores.
- Python:
NCBIWWW.qblast()+NCBIXML.read()(BioPython) - CLI:
blastn -remote -db nt -query seq.fa(BLAST+) - R:
blast()(rBLAST, local only)
Run BLAST searches against NCBI databases using Biopython's Bio.Blast module.
Required Import
from Bio.Blast import NCBIWWW, NCBIXML
from Bio import SeqIO
BLAST Programs
| Program | Query | Database | Use Case |
|---|---|---|---|
blastn |
Nucleotide | Nucleotide | DNA/RNA sequence similarity |
blastp |
Protein | Protein | Protein sequence similarity |
blastx |
Nucleotide | Protein | Find protein hits for DNA query |
tblastn |
Protein | Nucleotide | Find DNA encoding protein-like |
tblastx |
Nucleotide | Nucleotide | Translated vs translated |
Core Function
NCBIWWW.qblast()
Submit a BLAST query to NCBI servers.
from Bio.Blast import NCBIWWW
# Simple BLASTN search
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
Key Parameters:
| Parameter | Description | Example |
|---|---|---|
program |
BLAST program | 'blastn', 'blastp' |
database |
Target database | 'nr', 'nt', 'refseq_rna' |
sequence |
Query sequence | String or SeqRecord |
entrez_query |
Limit by Entrez query | 'Homo sapiens[organism]' |
hitlist_size |
Max hits to return | 50 |
expect |
E-value threshold | 0.001 |
word_size |
Word size | 11 for blastn |
gapcosts |
Gap penalties | '5 2' (open, extend) |
format_type |
Output format | 'XML' (default), 'Text' |
Common Databases
Nucleotide:
| Database | Description |
|---|---|
nt |
All GenBank + EMBL + DDBJ |
refseq_rna |
RefSeq RNA sequences |
refseq_genomic |
RefSeq genomic sequences |
Protein:
| Database | Description |
|---|---|
nr |
Non-redundant protein |
refseq_protein |
RefSeq proteins |
swissprot |
SwissProt (curated) |
pdb |
Protein structures |
Parsing Results
NCBIXML Parser
from Bio.Blast import NCBIWWW, NCBIXML
# Run BLAST
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
# Parse XML results
blast_record = NCBIXML.read(result_handle)
result_handle.close()
# Iterate hits
for alignment in blast_record.alignments:
print(f"Hit: {alignment.title}")
for hsp in alignment.hsps:
print(f" E-value: {hsp.expect}")
print(f" Score: {hsp.score}")
print(f" Identity: {hsp.identities}/{hsp.align_length}")
Alignment/HSP Attributes
# Alignment (hit) attributes
alignment.title # Hit description
alignment.accession # Accession number
alignment.length # Subject sequence length
alignment.hsps # List of HSPs
# HSP (High-scoring Segment Pair) attributes
hsp.score # Raw score
hsp.bits # Bit score
hsp.expect # E-value
hsp.identities # Number of identical positions
hsp.positives # Number of positive-scoring positions
hsp.gaps # Number of gaps
hsp.align_length # Alignment length
hsp.query # Aligned query sequence
hsp.match # Match line (| for identity)
hsp.sbjct # Aligned subject sequence
hsp.query_start # Query start position
hsp.query_end # Query end position
hsp.sbjct_start # Subject start position
hsp.sbjct_end # Subject end position
hsp.strand # Strand (blastn)
hsp.frame # Reading frame (blastx/tblastn)
Code Patterns
Basic BLASTN
from Bio.Blast import NCBIWWW, NCBIXML
sequence = '''ATGAAAGCAATTTTCGTACTGAAAGGTTGGTGGCGCACTTCCTGA'''
print("Running BLASTN (this may take a minute)...")
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
print(f"\nFound {len(blast_record.alignments)} hits")
for alignment in blast_record.alignments[:5]:
hsp = alignment.hsps[0]
print(f"\n{alignment.title[:70]}...")
print(f" E-value: {hsp.expect:.2e}")
print(f" Identity: {hsp.identities}/{hsp.align_length} ({100*hsp.identities/hsp.align_length:.1f}%)")
BLASTP with Organism Filter
from Bio.Blast import NCBIWWW, NCBIXML
protein_seq = '''MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'''
result_handle = NCBIWWW.qblast(
'blastp',
'nr',
protein_seq,
entrez_query='Mammalia[organism]',
hitlist_size=20,
expect=0.001
)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
for alignment in blast_record.alignments[:10]:
hsp = alignment.hsps[0]
print(f"{alignment.accession}: E={hsp.expect:.2e} - {alignment.title[:50]}...")
BLAST from FASTA File
from Bio import SeqIO
from Bio.Blast import NCBIWWW, NCBIXML
record = SeqIO.read('query.fasta', 'fasta')
result_handle = NCBIWWW.qblast('blastn', 'nt', record.seq)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
for alignment in blast_record.alignments[:5]:
print(f"{alignment.accession}: {alignment.title[:60]}...")
Save Results to File
from Bio.Blast import NCBIWWW
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
# Save XML for later parsing
with open('blast_results.xml', 'w') as out:
out.write(result_handle.read())
result_handle.close()
# Parse saved file
from Bio.Blast import NCBIXML
with open('blast_results.xml') as f:
blast_record = NCBIXML.read(f)
Extract Top Hits
Goal: Run a BLAST search and return a structured list of top hits with identity, coverage, and E-values.
Approach: Submit query with qblast, parse the XML result, and extract key metrics from each alignment's best HSP.
Reference (BioPython 1.83+):
def get_top_hits(sequence, program='blastn', database='nt', num_hits=10, evalue=0.01):
result_handle = NCBIWWW.qblast(
program, database, sequence,
hitlist_size=num_hits,
expect=evalue
)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
hits = []
for alignment in blast_record.alignments:
hsp = alignment.hsps[0]
hits.append({
'accession': alignment.accession,
'title': alignment.title,
'evalue': hsp.expect,
'identity': hsp.identities / hsp.align_length,
'coverage': hsp.align_length / blast_record.query_length
})
return hits
hits = get_top_hits(my_sequence, num_hits=5)
for hit in hits:
print(f"{hit['accession']}: {hit['identity']:.1%} identity, E={hit['evalue']:.2e}")
BLASTX (DNA to Protein)
from Bio.Blast import NCBIWWW, NCBIXML
dna_sequence = '''ATGAAAGCAATTTTCGTACTGAAAGGTTGGTGGCGCACTTCCTGA'''
result_handle = NCBIWWW.qblast('blastx', 'nr', dna_sequence)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
for alignment in blast_record.alignments[:5]:
hsp = alignment.hsps[0]
print(f"{alignment.accession}: frame {hsp.frame}, E={hsp.expect:.2e}")
print(f" {alignment.title[:60]}...")
Multiple Sequences
from Bio import SeqIO
from Bio.Blast import NCBIWWW, NCBIXML
import time
def blast_multiple(fasta_file, program='blastn', database='nt'):
results = {}
for record in SeqIO.parse(fasta_file, 'fasta'):
print(f"BLASTing {record.id}...")
result_handle = NCBIWWW.qblast(program, database, str(record.seq), hitlist_size=5)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
results[record.id] = blast_record
time.sleep(5) # Be nice to NCBI servers
return results
Filter by Identity/Coverage
Goal: Retain only BLAST hits meeting minimum identity and query coverage thresholds.
Approach: Iterate all alignments and HSPs, compute identity and coverage fractions, and collect those passing both cutoffs.
Reference (BioPython 1.83+):
def filter_blast_hits(blast_record, min_identity=0.9, min_coverage=0.8):
query_length = blast_record.query_length
filtered = []
for alignment in blast_record.alignments:
for hsp in alignment.hsps:
identity = hsp.identities / hsp.align_length
coverage = hsp.align_length / query_length
if identity >= min_identity and coverage >= min_coverage:
filtered.append({
'accession': alignment.accession,
'title': alignment.title,
'identity': identity,
'coverage': coverage,
'evalue': hsp.expect
})
return filtered
Common Errors
| Error | Cause | Solution |
|---|---|---|
| Timeout | NCBI servers busy | Retry later, use smaller query |
| No hits | Wrong database or program | Check program/database match |
| Empty results | E-value too stringent | Increase expect parameter |
| URLError | Network issue | Check connection, retry |
Timing Notes
- Remote BLAST can take 30 seconds to several minutes
- Longer queries take longer
- Peak times (US business hours) may be slower
- For many queries, consider local BLAST
Decision Tree
Need to BLAST a sequence?
├── DNA query?
│ ├── Against DNA database? → blastn
│ └── Against protein database? → blastx
├── Protein query?
│ ├── Against protein database? → blastp
│ └── Against DNA database? → tblastn
├── Want to limit organisms?
│ └── Use entrez_query parameter
├── Need many searches?
│ └── Consider local-blast skill
└── Need results fast?
└── Use local-blast skill
Related Skills
- local-blast - Run BLAST locally for faster, unlimited searches
- entrez-fetch - Fetch full records for BLAST hits
- sequence-io - Read query sequences from files